PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00346.1_g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 138aa    MW: 15911.9 Da    PI: 6.5427
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00346.1_g00015.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.2e-09811152155
                              HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                 Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                              k +yp++ ++  LA+ +gL+++q+ +WF N+R ++
  Rsa1.0_00346.1_g00015.1  81 KWPYPTEGDKIALADATGLDQKQINNWFINQRKRH 115
                              569*****************************985 PP

2ELK31.73.4e-113556122
                      ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                             +LK++LlrK++++++sLk EFs
  Rsa1.0_00346.1_g00015.1 35 DLKDRLLRKFGSRISSLKLEFS 56
                             69*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512139.833555IPR005539ELK domain
SMARTSM011886.3E-53556IPR005539ELK domain
PfamPF037898.0E-83556IPR005539ELK domain
PROSITE profilePS5007112.37455118IPR001356Homeobox domain
SuperFamilySSF466892.4E-2056132IPR009057Homeodomain-like
SMARTSM003891.0E-1257122IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.8E-2860119IPR009057Homeodomain-like
CDDcd000863.02E-1167119No hitNo description
PfamPF059207.0E-1875114IPR008422Homeobox KN domain
PROSITE patternPS00027093116IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MSGSSLEDGA VSSDEELNGG DEILQDGKQI CEDRDLKDRL LRKFGSRISS LKLEFSKKKK  60
KGKLPKEARQ ALLDWWNVHY KWPYPTEGDK IALADATGLD QKQINNWFIN QRKRHWKPSE  120
NMPFAMMDDS SGSFFTEE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0723611e-104AB072361.1 Arabidopsis thaliana KNAT6S mRNA for homeodomain transcription factor KNAT6, complete cds.
GenBankAB0723621e-104AB072362.1 Arabidopsis thaliana KNAT6L mRNA for homeodomain transcription factor KNAT6, complete cds.
GenBankBT0029301e-104BT002930.1 Arabidopsis thaliana clone RAFL14-89-I21 (R20256) putative homeodomain transcription factor KNAT6 (At1g23380) mRNA, complete cds.
GenBankBT0043701e-104BT004370.1 Arabidopsis thaliana clone U20256 putative homeodomain transcription factor KNAT6 (At1g23380) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009115534.12e-93PREDICTED: homeobox protein knotted-1-like 6 isoform X1
RefseqXP_013717242.12e-93PREDICTED: homeobox protein knotted-1-like 6 isoform X1
SwissprotQ84JS61e-82KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLA0A078JRS21e-94A0A078JRS2_BRANA; BnaAnng30720D protein
STRINGBra024591.1-P6e-93(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8352785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.15e-74KNOTTED1-like homeobox gene 6